PACKAGING PREVIEW · KCC-XX
Illustrative chrome-paper vial, not inventory photography. Supplied label claims are not verified analytical results.
Peptide research material
Tesamorelin
KCC-TES-020
20 mg
Cataloged for qualified non-clinical laboratory research; identity and lot documentation are required before release.
Nominal amount
Release status Documentation pending
Available for research purchase with documentation pending. No approved COA has been published. Purity and any unverified expiration are not verified results. You must accept this disclosure at checkout.
Catalog price$160.00
Current payment methods: PayPal · Cash App · Zelle
Shipping is limited to eligible U.S. destinations. Shipping and applicable tax are calculated after you enter your address and select delivery, before you pay. Payment and order details must be verified before fulfillment; carrier delivery times are separate.
Images are packaging concepts, not photographs of actual inventory or evidence of a lot’s documentation.
Documentation pending: No approved COA has been published. Unverified purity and expiration are not verified results. This disclosure requires acknowledgment at checkout.
Shipping policy → · Returns & claims policy → · Need help? →For laboratory research use only. Not for human or veterinary use.
IDENTITY & SPECIFICATIONS
Exact identity first.
- Catalog number
- KCC-TES-020
- Material identity
- Tesamorelin
- Nominal amount
- 20 mg
- Material type
- Peptide research material
- Use classification
- Laboratory research use only
LITERATURE REFERENCE
Molecular identity
Published structural information for research review—not measured results, a certificate of analysis, or confirmation of a KCC lot’s identity. Match the exact form to released supplier and lot documentation before use.
Tesamorelin
Parent compound; counterions and hydration excluded
Reference sequence / structural notation
{trans-3-hexenoyl}-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2- Backbone residues
- 44
- Reference formula
- C221H366N72O67S
- Reference molecular weight
- 5135.9 g/mol
- Reference CAS
- 218949-48-5
N-terminal trans-3-hexenoyl modification and C-terminal amide, following the reference structural diagram. Formula and mass exclude acetate; no equivalence to an approved finished medicine is implied.
How to read the notation
Sequences run from N to C. Ac = acetyl; -NH2 = C-terminal amide; -OH = free C-terminal acid; D- marks stereochemistry; Aib = α-aminoisobutyric acid; Nle = norleucine; pGlu = pyroglutamate; γ-Glu = gamma-glutamyl linkage; AEEA = 2-[2-(2-aminoethoxy)ethoxy]acetic acid. Lipid linkers and ring closures are described separately. Molecular weights are reference molar masses, not measured MS peaks or per-vial amounts.
Reference review: September 6, 2026 · Research use only
RESEARCH CONTEXT
Research areas & sources.
Growth hormone-releasing hormone (GHRH) and endocrine/metabolic research.
These references explain the research classification. They are not evidence of testing, purity, safety, or efficacy for a KCC Labs product or lot, and do not authorize human or veterinary use.
AVAILABLE LOTS
Release-specific status.
No approved COA is published for this material yet.
Available for research purchase with documentation pending. No approved COA has been published. Purity and any unverified expiration are not verified results. You must accept this disclosure at checkout.
ANALYTICAL DOCUMENTS
Evidence tied to the lot.
No approved analytical document is publicly linked yet.
A generic certificate is not evidence for this material. Published COAs must correspond to the exact released batch.
Review the quality framework →STORAGE & HANDLING
Follow the applicable COA and documentation.
Storage, handling, physical form, and stability conditions may vary by material and lot. Use only the instructions supplied with the released documentation and your institution’s approved laboratory procedures. Do not rely on third-party clinical or administration protocols.
What the lab record should establish
Documentation guide—not a claim that these assays have been performed. Only the approved document for the exact lot can establish results. An absent report means no result is published, not that a test passed.
- Identity & structure
- Mass spectrometry / LC–MS and sequence or structural confirmation, as applicable.
- Purity & content
- Lot-specific chromatogram, method and purity result; net compound content reported separately from chromatographic area percentage.
- Chemical form & impurities
- Counterion, hydration, residual solvents and relevant elemental impurities, where characterized.
- Handling & traceability
- Exact lot, SDS, physical form, storage conditions and supported retest or expiry date. Microbiological or endotoxin results only when applicable and documented.
PROCUREMENT
Clear before commitment.
AvailabilityAvailable for review
Purchaser21+ and qualified
DestinationEligible U.S. addresses
Final confirmationBefore payment and fulfillment